#wardah

Ladies, segarkan kembali wajahmu dengan wardah sheet mask yg hadir 5 variant Vitamin C, Aloe Vera, Rose, Rice dan Green Tea dengan manfaat yang berbeda-beda sesuai dengan kebutuhan kulitmu. . . Wardah Nature Daily Sheet Mask, today calming, tomorrow sooting, next brightening, moisturizing and revitalizing. Feel Refreshed Everyday! #wardah #wardahnaturedaily #wardahfeelthebeauty #wardahfeelrefreshed #maskermakassar @yourstore.u

0 0
30.05.2020 15:31:44
View

Wardah Staylast Waterproof Liquid Eyeliner (Black) Eye Expert Series Color : Black Isi : 3.5 gr Dilengkapi dengan formula cepat kering serta reflex pearl yang glossy, Wardah Staylast Liquid Eyeliner merupakan pilihan tepat untuk riasan sehari-hari. Aplikator kuasnya juga sangat lembut dan lentur sehingga memudahkan pengguna untuk membentuk garis, baik tebal maupun tipis. Membuat mata terlihat lebih tegas sehingga sangat cocok untuk perempuan yang ekspresif dan berani tampil beda. Memiliki daya tahan yang lama dan bisa dipakai seharian, meskipun terkena keringat atau air wudhu. Pengguna juga tak perlu khawatir saat berwudhu, karena air akan tetap menyerap ke dalam pori-pori kulit berkat formula smudge-proof yang membuat air bisa menyerap ke dalam kulit. Memiliki kandungan emollient yang berguna untuk melembutkan dan menghaluskan kulit. Kelebihan Wardah Staylast Liquid Eyeliner: - Warna hitam pekat dan memberikan hasil yang glossy. - Cepat kering. - Tahan lama dan mudah dibersihkan dengan air. - Aplikatornya lembut dan sangat applicable. #wardah #wardahbeauty #wardahlipcream #wardahhalaldariawal #wardahhalal #wardahcosmetics #wardahbodybutter #wardahbodylotion #wardahmurah #wardahlonglastinglipstick #wardahlipcreammatte #wardahcreamybodybutter #wardahdailynutrivegel #wardahdailymask #wardahkapsulmask #wardaheyexpert #wardahexpertseries #wardah #wardahbeauty #wardahexpertmascara #wardahori #maskarawaterproof #wardaheyexpert #wardaheyeliner #wardaheyelinerliquid #wardaheyexperteyeliner #wardahstaylastliquideyeliner Harga : 49.900

0 0
30.05.2020 15:22:25
View

Kalo kakak2 lagi buru-buru nih mendadak harus keluar rumah, pengen keliatan pake makeup tapi tetap terlihat natural. Atau hanya sekedar buat selfie2 di rumah aja. Aku sarankan pake perfect bright tone up cream dan juga perfect bright bb loose powder. Ini loh rangkaian perfect bright series wardah yg mampu meratakan warna kulit dan jadikan wajah cerah seketika bebas kilap! Sudah ada kandungan 7 mattifying benefits pada loose powder dan spf 25 pada moisturizer juga double uv protection untuk melindungi kulit kamu dari paparan sinar uv a dan uv b! Jadi ga perlu khawatir lagi kulit belang kalo keluar rumah yaaaa😁 @selvinaeka @dessydwicahyani @tatifarandy #makeup #wardah #wardahcosmetics #paragonbandung #brandlokal

0 15
30.05.2020 15:21:40
View

📣📣KUPON🥳🥳🥳 . Ini nihh kupon yang bakal kalian dapet kalau udah belanja Rp50.000,- yaa🤗🌈 . Syarat : 1. Follow akun @afna_shop227 2. Spam Like . Info lebih lanjut WA 088 2325 10271 . Ajak teman kamu sebanyak-banyaknya👍🏻 Happy Shopping🙏🏻💕 . #promo #promokosmetik #wardah #wardahbeauty #wardahkosmetik #wardahmurah #eminamurahungaran #eminacosmetics #emina #eminamurahsemarang #eminamurahsalatiga #kosmetikmurahbanget #kosmetik #kosmetikmurahpurwokerto #kosmetikpromo #kosmetikmurahungaran #kosmetikmurahsalatiga #kosmetikmurahsemarang

0 1
30.05.2020 15:20:37
View

Wardah Nature Daily Sheet Mask Isi : 20 ml Original & BPOM Micro Particle Essence yang memiliki ukuran partikel sangat kecil sehingga essence dapat meresap lebih cepat. 100% Lyocell Fibers pada sheer mask membuat terasa lembut dan halus dan menempel dengan baik pada kulit wajah. Kandungan natural yang sesuai dengan kebutuhan kulit. Cara pakai : - Bersihkan wajah. - Buka layer luar ,aplikasikan masker pada wajah,hindari area mata dan leher. - 15-20 menit beri tepukan lembut agar Essence menyerap maksimal. BAHAN KANDUNGAN : Micro Partical Essence yg sangat kecil hingga mudah terserap kulit lebih cepat dan 100% Lyocell fibers membuat kulit terasa lembut,halus dan natural. Terdapat 5 Macam Varian: - GREEN TEA (menyejukan kulit dan mengurangi kemerahan akibat iritasi) - ALOE VERA (melembabkan kulit kering) - ROSE (kulit lebih halus,lembut dan bercahaya) - RICE (menjaga kelembaban kulit dari dalam) - VITAMIN C (mencerahkan kulit dan meratakan warna kulit) #wardah #wardahbeauty #wardahlipcream #wardahhalaldariawal #wardahhalal #wardahcosmetics #wardahbodybutter #wardahbodylotion #wardahmurah #wardahlonglastinglipstick #wardahlipcreammatte #wardahcreamybodybutter #wardahdailynutrivegel #wardahdailymask #wardahkapsulmask #wardaheyexpert #wardahexpertseries #wardah #wardahbeauty #wardahexpertmascara #wardahori #maskarawaterproof #wardahnaturedaily #wardahnaturedailyseries #wardahnaturedailysheetmask #greentea #rose #aloevera #rice #vitaminc Harga : 22.000

0 0
30.05.2020 15:20:20
View

📣📣KABAR GEMBIRA🥳🥳🥳 . Buat kalian yang udah dapet poin pastikan kalian juga dapet free produk yaaa🤗🌈 . Syarat : 1. Follow akun @afna_shop227 2. Spam Like 3. Komen postingan ini dan mention 3 temen kalian . Pemenang akan di undi dengan aplikasi, pastikan jangan lupa KOMEN🙏🏻 Info lebih lanjut WA 088 2325 10271 . Ajak teman kamu sebanyak-banyaknya👍🏻 Happy Shopping🙏🏻💕 . #promo #promokosmetik #wardah #wardahbeauty #wardahkosmetik #wardahmurah #eminamurahungaran #eminacosmetics #emina #eminamurahsemarang #eminamurahsalatiga #kosmetikmurahbanget #kosmetik #kosmetikmurahpurwokerto #kosmetikpromo #kosmetikmurahungaran #kosmetikmurahsalatiga #kosmetikmurahsemarang

0 1
30.05.2020 15:18:57
View

Wardah Volume Expert Mascara Isi : 7gr Original & BPOM Wardah Volume Expert Mascara dengan teknologi brush inovatif lash precision brush, didesain sempurna untuk dapat menjangkau bulu mata terkecil sekaligus, membantu memisahkan setiap helai bulu mata, mengangkat bulu mata secara optimal dari pangkalnya, lalu menebalkan dan melentikkannya seketika. Dengan formula 5 in 1 yang halal dalam setiap lapisannya! WidelashTM, kompleks matrikin yang kaya vitamin, bantu menonjolkan penampilan alami bulu mata. Intense pigmented waterproof color yang melapisi setiap bulu mata dengan pigmen warna dari pangkal hingga ke ujungnya sehingga bulu mata tampak lebih tebal. No clump and smudge. No tackiness. Argan oil yang bantu merawat setiap helai bulu mata. Serta film forming agent yang melapisi formula inovatifnya secara waterproof dan fast drying formula sehingga nyaman digunakan sepanjang hari. #wardah #wardahbeauty #wardahlipcream #wardahhalaldariawal #wardahhalal #wardahcosmetics #wardahbodybutter #wardahbodylotion #wardahmurah #wardahlonglastinglipstick #wardahlipcreammatte #wardahcreamybodybutter #wardahdailynutrivegel #wardahdailymask #wardahkapsulmask #wardaheyexpert #wardahexpertseries #wardah #wardahbeauty #wardahexpertmascara #wardahori #maskarawaterproof Harga : 69.900

0 0
30.05.2020 15:17:46
View

📣📣Hollaaa🥳🥳🥳 . Ini nihh produk-produk yang bisa kalian dapetin tanpa diundi lohh, langsung free produk ini sesuai pembelanjaan kalian🤗🌈 . Syarat : 1. Follow akun @afna_shop227 2. Spam Like 3. Tukar poin yang kalian dapatkan via DM/Wa . Info lebih lanjut WA 088 2325 10271 . Ajak teman kamu sebanyak-banyaknya👍🏻 Happy Shopping🙏🏻💕 . #promo #promokosmetik #wardah #wardahbeauty #wardahkosmetik #wardahmurah #eminamurahungaran #eminacosmetics #emina #eminamurahsemarang #eminamurahsalatiga #kosmetikmurahbanget #kosmetik #kosmetikmurahpurwokerto #kosmetikpromo #kosmetikmurahungaran #kosmetikmurahsalatiga #kosmetikmurahsemarang

0 1
30.05.2020 15:16:13
View

Menangislah ketika kamu sangat bahagia dan tersenyumlah ketika kamu bersedih 😅 kebalik oon 😜 IB @trimaaar_ #makeup #karakter #makeuppainting #makeuptutorial #makeuplucu #maybelline #wardah #raneecosmetic #garnier #dirumahsaja #hijabstyle #sidoarjo #tamansidoarjo

0 7
30.05.2020 15:14:15
View

Hai beauty's Seharian beraktivitas di luar rumah bisa membuat wajahmu terlihat kering dan kusam. Untuk perawatan prioritas harianmu, jangan lupa selalu membersihkan wajah dengan Wardah Nature Daily Aloe Hydramild Series. Kandungan aloe vera dan vitamin E bisa membantu membersihkan sekaligus membantu melembapkan kulit keringmu. Rahasianya? Gunakan cleanser, toner, serum, gel dan moist creamnya untuk menjadi perawatan wajah harianmu. Bye bye kulit kering dan kusam! #wardah #wardahnaturedaily #wardahnaturedailyseries #naturedaily #produkfavorit #selaluadabahagia #penggerakkebaikan #berbagiuntukbahagia #wardahskincaretoshare @fithrinisrina @purnamasariindah8 @handayani_cc

0 3
30.05.2020 15:11:56
View

Instaperfect Series - Wardah Instaperfect Matre Centric Lip Crayon Harga 85.000 - Wardah Instaperfect Gloss Chic Lip Crayon Harga 85.000 - Wardah Instaperfect Browfessional 3D Brow Mascara Harga 85.000 - Wardah Instaperfect City Blush Blusher Click 5,6 gr Harga 115.000 - Wardah Instaperfect Mattetitude Matte Stain Lipstik 3,5 gr Harga 71.500 - Wardah Instaperfect Mattesetter Lip Matte Paint 5,5 gr Harga 84.500 - Wardah Instaperfect Mineralight Matte BB Cushion SPF 29 Harga 168.500 ( Refill 130.000 ) - Wardah Instaperfect Porefection Skin Primer 20 ml Harga 71.500 - Wardah Instaperfect Matte Fit Powder Foundation 13 gr Harga 114.000 ( Refill 80.000 ) - Wardah Instaperfect Hypergetic Precise Black Liner Harga 83.000 - Wardah Instaperfect Geniustwist Matic Counter Brow Brushed 0,25 gr Harga 76.000 - Wardah Instaperfect Dynamatic Microsmooth Liner Harga 71.500 - Wardah Instaperfect Quick Fix Cover Corect Concealer 1,8 gr Harga 100.000 - Wardah Instaperfect Spotlight Chromatic Eye Pallette Harga 142.500 #instaperfectseries #wardah #wardahcosmetics #wardahcantikdarihati #wajahalami #wajahglowing #wajahbersih #cantik #kecantikan #kecantikanwajah #love #lovequotes #taglikeforlikes #likeforlikes #jakartahits #indonesian #lighteningserieswardah #wardah #wardahcosmetics #wardahcantikdarihati #wajahalami #wajahglowing #wajahbersih #cantik #kecantikan #kecantikanwajah #love #lovequotes #taglikeforlikes #likeforlikes #jakartahits #indonesian

0 1
30.05.2020 15:07:59
View

In syaa'Allah amanah. .. .. #nattareza #wardah #sirwal #kurtahoodie #rosal #polo #distrobandung #distrolampung #nattareza_wardahmaulina

0 1
30.05.2020 14:57:40
View

Always remember you are braver than you believe. Stronger than you seem. Smarter than you think. Loved more than you know. ~ Wardah Wisdom ~ • • • _________ⓢⓐⓥⓔⓔⓝⓐ_________ • • • #duosasa #saveena #saveetri #veena #veetri #duo #duet #bestfriend #bestie #beautiful #drag #queen #dragqueen #show #cheers #smiling #entertain #diary #activity #makeup #wardah #instagramer #instafamous #wardahbeauty #wardahcosmetics #wardahcseries #inspiringbeauty #cantikdarihati #selaluadabahagia #dirumahtetepcantik

2 11
30.05.2020 14:54:34
View

Hai fwends! Jadi aku mau ngasih tau skincare favorite aku ! Aku pake dari rangkaian "C-Defense" series sumpah cocok banget 😭🥰 kulit aku jadi lebih ternutrisi dan lebih cerah karna udah ada kandungan Hi-grade vitamin C 🥰🌼 secinta itu aku sama produk ini!! Dan untuk kalian semua yang lagi #ᴅɪʀᴜᴍᴀʜᴀᴊᴀ jangan lupa buat tetap nherawat kulit kalian 🤗💙 buat kalian yg masih diharuskan beraktifitas diluar jangan lupa pake masker yaaa !! Luvv yu💙 #wardah #wardahbeauty #dirumahaja #skincare @riztiyanaizty @shiskaamanda @richaarifiani

0 73
30.05.2020 14:46:54
View

Untuk semua Pejuang 2 Garis Merah Anda adalah pasangan yang luar biasa Jangan menyerah tetap semangat karena Tuhan bersama Orang orang yang Yakin dan bersungguh sungguh 😇💪 . . Jangan lupa aktifkan notifikasi kiriman ada agar bisa update info kesehatan terbaru 😉 Mau Konsultasi masalah kesehatan GRATIS? Kalian bisa chat di Bio instagram kami yah 👉 @dokter_sehat_id . Semoga bermanfaat, semoga membantu!🙏🙏 . Atau bisa hubungi WA: 08990498711 Source: Cermin pasutri

6 91
30.05.2020 14:34:31
View

Laneige Clear C Peeling Serum 80ml Expired 2022 Poin-poin penting: 1. Asam malat turunan tanaman AHA Menjadikan lapisan cornified sehat sehat dan mengangkat sel kulit mati. ( Berasal dari gula maple, tebu, jeruk, lemon, dan billberry) 2. Enzim yang berasal dari tumbuhan dan fermentasi lactobacillus yang berasal dari tumbuhan Menghilangkan sel-sel kulit mati yang tidak rapi dan membuat kulit terasa halus Laneige Clear-C peeling serum mengandung enzim, sehingga hanya merespon sel-sel kulit mati yang terkelupas. Secara khusus, ketika tekstur kulit tidak merata selama pergantian musim, produk yang mengandung enzim membuat permukaan kulit terasa halus dan rata dengan merawat sel-sel kulit mati yang terkelupas. Bagaimana cara menggunakan: LANGKAH 1: Gunakan setiap pagi dan malam, sern mengoleskan toner. LANGKAH 2: Gunakan peeling serum 2-3 pompa, oleskan pada wajah, dan tepuk de lembut untuk meningkatkan penyerapan ke dalam kulit. Gunakan secara teratur. #dirumahsaja #somebymi #skincare #glowingskin #somethinc #laneige #innisfree #banilaco #makeup #huxley #klairs #theordinary #avoskin #lacoco #nacific #missha #wardah #pixy #naturerepublic #huxley #cosrx #cicapair #iunik #sunscreen #serum #toner #essence #nightcream #daycream #sleepingmask

0 2
30.05.2020 14:34:09
View

I'm the super oily skintype :< Don't need to be worry bcs of this @wardahbeauty Mineral and Clarifying Clay Mask 🖤 #skincare #claymask #wardah #bachallengew20 #wardahskincaretoshare #berbagiuntukbahagia #selaluadabahagia

0 70
30.05.2020 14:29:07
View

Wardah Instaperfect Mineralight Matte BB Cushion Harga: 148.000 Harga Refill: 117.000 Cushion SPF 29 PA+++ Perfect Radiant Matte seketika! Mineralight Matte BB Cushion, dengan smart high coverage technology serta Mineralight Fix, bahan mineral natural yang menjaga kulit tetap terhidrasi dari dalam dan memberikan cooling sensation di kulit aktif sekalipun. kini wajah tampak perfect radiant matte Tersedia: 11. Fair 12. Evory 13. Beige 14. Creme Order? DM atau Line (link di bio) #wardah #wardahbogor #wardahjakarta #wardahdepok #wardahtanggerang #wardahbekasi #wardahgrosir #makeupwardah #skincarewardah #wardahinstaperfect #wardahinstaperfectseries #wardahinstaperfectmineralightmattebbcushion

0 6
30.05.2020 14:26:25
View

Hi gengs... Walaupun #dirumahaja Harus tetep Jaga kelembaban kulitmu yah.. . Yang Pertama " Wardah Nature Daily Aloe Hydramild Facial Wash " selalu bersihkan wajah dengan facial wash yang dapat melembabkan Dan melembutkan kulitmu.. . Kedua " Wardah Nature Daily Aloe Hydramild Multifunction Gel " Vitamin A, B12, C, E, asam folat dan kolin pada lidah buaya berfungsi meremajakan Kulit, menyegarkan, melebabkan dan menenangkan wajah.. . Ketiga " Wardah Nature Daily Sheet Mask Aloe Vera " self pampering dengan sheet mask dan rasakan kelembapan dari Aloe Vera Exctract! . . Bagi Kalian yang mau produk ini langsung aja ke Gajah Mada Swalayan & Abadi Jaya Kosmetik atau bisa DM aku.. . . @rinisetiapti @uyasantoso @asrinura @fitriernaerna @evinovia26 . #penggerakkebaikan #berbagiuntukbahagia #selaluadabahagia #wardahskincaretoshare #wardahbeauty #wardah #wardahsurabaya #wardahsurabayascts #challengewardahuya #dcsurabaya #inspiringbeauty #naturedaily #dirumahaja #flf #lfl

0 25
30.05.2020 14:24:29
View

Deo Spray SR12 Cara Pemakaian: Semprotkan Deodorant spray setelah habis mandi di ketiak 2-3 semprot lalu usap. Larutan ini tidak berbau, tidak mengandung alkohol. KELEBIHAN DEODORANT SR12 DIBANDINGKAN DEODORANT LAIN * Tahan lama sampai 24 Jam lebih (24 jam - 36 jam) * Cukup disemprotkan pada ketiak/sumber bau * 100% Herbal * Aman tanpa efek samping * Tidak mengandung Alkohol / Non Alcohol * Tidak berbau * Tidak meninggalkan bekas pada pakaian * Membunuh bakteri penyebab bau badan (Deodorant lain hanya menutupi bau) * Tidak menimbulkan iritasi pada kulit. * Bisa mengendalikan keringat berlebih dan mencerahkan kulit ketiak yang hitam * Ekonomis karena 1 x dipakai setelah mandi SAYA JAMIN 100% SUDAH TERBUKTI AMPUH biasa 43rb premium 48rb 95 gram #msgloworiginal #msglowmedan #msglowbpom #kosmetikmurahmedan #tokokosmetik #kosmetikoriginal #kosmetikremaja #makeupmedan #kosmetikmurah #wardahmedan #eminamedan #jualkosmetik #msglow #softlens #soflens #creammsglow #hanasui #emina #wardah #wardahmedan #eminamedan #imploramedan #madamgie #madamgiemedan #kutekhalal #deospraysr12 #sr12medan

0 0
30.05.2020 14:23:13
View

Caption apa nih??? By:@nadine.toty #lfl #makeovercosmetics #wardah #dirumahaja #lfl💛 #lfl💛lfllflfllffllflflflflflflflflfllflflflflflflflflflflflflflflflflflflflflflflflflflflflflfllflflflflflflflflfllflfllflflflflflflfllflflflflflllfl

14 32
30.05.2020 14:17:49
View

Wardah Instaperfect Mattesetter Lip Matte Paint Harga: 76.500 formula yang nyaman di bibir dan tahan lama hingga 12 jam. Hanya perlu satu kali pulas tanpa perlu effort berlebih untuk touch up. Mattifying agent->hasil akhir tampak matte dan tidak kering. Warna pigmented, formula creamy-mousse dan non-transferproof Tersedia 1. Glee 2. Dear 3. Chic 4. Vibe 5. Hype 6. Flaire 7. Dazzle 8. Edge 9. Icon Order? DM atau Line (link di bio) #wardah #wardahbogor #wardahjakarta #wardahdepok #wardahtanggerang #wardahbekasi #wardahgrosir #makeupwardah #skincarewardah #wardahinstaperfect #wardahinstaperfectseries #WardahInstaperfectMattesetterLipMattePaint

0 5
30.05.2020 14:17:31
View

RESTOCK Berkali kali tetapi tetep ludes lagi dan ludes lagi si Khimar Nada ini 😊 Kali ini ready tetapi ga banyak ya kesayangan...jadi lebih baik segera chat ke admin yah 😘 PENGIRIMAN ESTIMASI 20 MARET Harga 195.000 / Khimar Only ✔ 1 Kg Muat 4 Khimar jd sayang cuma beli 1 aja 😁 . - Bahan: ceruty premium Panjang depan: 115cm Panjang belakang: 135cm Oiyaaa, khimar nada kali ini hadir dengan revisi pad formula terbaruu insyaAllah lebih ngeplek lg lho 🤗 . . . #arniz #gamis #khimar #mayra #hijabshop #syaricantik #syarimedan #butikmedan #butikbinjai #olshopsyari #grosirgamismedan #grosirgamis #wiwiek #wardah #putrimuslimah #hawwaaiwa #aliyasyarialhayya #sukriyafashion #joza #jawhara #ulyahijab #zeeaudrey #ermacyfa #deanara #rdk #lyravirna #sisesa #kameela #bugio #aliyasyarihou

0 10
30.05.2020 14:17:26
View

RESTOCK Berkali kali tetapi tetep ludes lagi dan ludes lagi si Khimar Nada ini 😊 Kali ini ready tetapi ga banyak ya kesayangan...jadi lebih baik segera chat ke admin yah 😘 PENGIRIMAN ESTIMASI 20 MARET Harga 195.000 / Khimar Only ✔ 1 Kg Muat 4 Khimar jd sayang cuma beli 1 aja 😁 . - Bahan: ceruty premium Panjang depan: 115cm Panjang belakang: 135cm Oiyaaa, khimar nada kali ini hadir dengan revisi pad formula terbaruu insyaAllah lebih ngeplek lg lho 🤗 . . . #arniz #gamis #khimar #mayra #hijabshop #syaricantik #syarimedan #butikmedan #butikbinjai #olshopsyari #grosirgamismedan #grosirgamis #wiwiek #wardah #putrimuslimah #hawwaaiwa #aliyasyarialhayya #sukriyafashion #joza #jawhara #ulyahijab #zeeaudrey #ermacyfa #deanara #rdk #lyravirna #sisesa #kameela #bugio #aliyasyarihou

0 10
30.05.2020 14:14:09
View

nah ini dia list produk yang aku pakai di look make up ala aku dan semuanya pakai produk wardah dan aku syukak sekali karena gak kalah keren sama produk mehong lainnya 😆 . . . . ⚪ Wardah Eyebrow pencil black ⚪Wardah Exclusive liquid foundation no. 02 ⚪ Wardah Exclusive two way cake no. 02 ⚪ Wardah Exclusive blush On no. 02 ⚪ Wardah Exclusive eyeshadow pallate no.01 ⚪ Wardah Exclusive lip cream no. 11 ⚪ Wardah Eyeshadow passionate ⚪ Wardah optimum hi black liner . . . . #makeuptutorial #wardahbeauty #wardah #beautybloggers #beautiful #muajakarta #muatangerangselatan #indobeautygram #indobeautyvlogger #arabianlook #makeupdaily #makeuparab

2 20
30.05.2020 14:12:54
View

🐾AliaMo treatment 🐾 Melayani : √ Facial √ Ratus √ Luluran / bodyscrub √ Pijet lulur √ Bodyspa √ Totok wajah √ Mini facial √ Galvanic spa Bisa dipanggil kerumah khusus daerah cirebon . . . For book Klik link di bio aku . . Bisa langsung masuk ke whatsapp tanpa harus save nomer 😊🙏 . . . #salon #homeservice #like4likes #xoxo #cirebonjeh #cirebon #cirebonbribin #aboutcirebon #cantik #facial #lulur #praktis #metime #sehat #aliamotreatment #ratus #mua #pijettradisional #natural #galvanicspa #nuskin #biokos #wardah #viva #ertos #spa #spacirebon #pijetlulur #sauna #marthatilaar

0 3
30.05.2020 14:00:09
View

“Watermelon Balm Juice” Merupakan cleansing balm untuk membersihkan makeup kamu hanya dalam sekali usap 😘🌸 Balm Juice ini berbentuk balm yg pada saat pengaplikasiannya berubah menjadi minyak dan sangat mudah saat menghapus makeup hanya dalam “ satu kali usap” . Memiliki kandungan seperti : - Watermelon Extract terbuat dari bahan alami buah semangka - Beeswax (lilin lebah) : zat pelembab, memberikan serta menjaga kelembaban kulit, mengandung vitamin A bermanfaat untuk melembutkan & menyegarkan kulit kering - Jojoba Oil (minyak alami) : untuk melembabkan kulit, mencegah jerawat, mengatasi komedo, anti-aging dan mencegah stretch mark dgn melembutkan kulit - Aloe Barbadensis Leaf Extract : tananam yg kaya akan protein, kalsium, vitamin A,C & E untuk melembabkan kulit, meremajakan kulit, berfungsi sebagai antibakteri dan antiinflamasi . Tak hanya itu banyak manfaat ajaib yg bisa kita dapatkan dari buah ini seperti membuat kulitmu lebih segar, mencegah penuaan dini, melembabkan kulit, mengurangi minyak berlebih, meremajakan kulit & obat jerawat ❤ ⁣. #msglow #msglowbeauty #msglowjakarta #msglowsurabaya #msglowmalang #redjellymsglow #msglowmagelang #creamdokter #creamglowing #creampemutih #creampemutihwajah #creamwajah #skincare #daycreamglowing #wardah #kfskin #ertos #beauty #lipcream #implora #pemutihkulit #scarlet #pemutihwajah #pemutihkulit #kosmetikmurah #kosmetik #obatjerawat #obatflek @ West Nusa Tenggara

0 23
30.05.2020 13:59:17
View

SOMEBYMI Galactomyces Pure Vitamin C Glow Toner 200ml Galactomyces untuk wajah glowing, mencerahkan, anti-oksidan, melembabkan, menutrisi & vitalitas. Mengandung 88% air fermentasi galactomyces sebagai ganti air biasa, 1% (10,000ppm) Vitamin C, 10 jenis vitamin yang di re-create agar lebih mudah terserap & EWG green grade prescription (tanpa pewarna & pewangi) Fungsi : - Merawat Kulit Kering - Merawat Kulit Kusam - Merawat Wajah yg Berkerut - Meratakan Warna Kulit Wajah yg Tidak Rata - Merawat Jerawat Mengecilkan Pori-Pori Wajah - Menghilangkan Flek Menghilangkan Noda Bekas Jerawat #dirumahsaja #somebymi #skincare #glowingskin #somethinc #laneige #innisfree #banilaco #makeup #huxley #klairs #theordinary #avoskin #lacoco #nacific #missha #wardah #pixy #naturerepublic #huxley #cosrx #cicapair #iunik #sunscreen #serum #toner #essence #nightcream #daycream #sleepingmask

0 6
30.05.2020 13:58:00
View

Pilih Warna Lipstik yang Tepat untuk Rona Kulit Anda 1. Rona Merah Oranye dan Coral Warna seperti ini nyatanya amat tepat untuk Anda yang memiliki rona kulit netral dan hangat, apalagi bila kulit Anda tergolong sawo matang! Anda bisa coba warna Sunset Show atau Flashy Coral. 2. Rona Keunguan dan Merah Tua Rona merah keunguan serta merah gelap ini paling pas diaplikasikan pada kulit yang memiliki rona dasar sejuk. Coba warna Berry Bliss, Red Haute Couture. 3. Rona Pink Rosy Ingin tampil bak putri kali ini? Apabila kulit Anda memiliki rona dasar sejuk, segera pulaskan lipstik warna Uptown Rose. Ingin tampil lebih glam? Pilih Cranberry Blush! 4. Rona Pink serta Merah Klasik Waktunya untuk tampil ekstra PD bagi pemilik rona kulit sejuk dengan warna merah klasik, seperti Fatal Red yang akan membuat gaya Anda makin keren! Atau, tampil super trendi dengan Clover Dream. 5. Rona Nude Kecokelatan Apabila Anda memiliki kulit yang hangat dan menginginkan rona yang tampak natural? Pilihan paling tepat tentu jatuh pada warna Rosewood Charm. Tak hanya memiliki 10 rona yang dirancang agar tahan lama, formula baru The ONE Colour Stylist Ultimate Lipstick mengandung Colour Coverage Pigments untuk memberikan rona pekat dalam satu kali pulasan. Istimewanya lagi, ada teknologi Sculpt & Sign Bullet yang mampu mendefinisikan bibir dan memudahkan pengaplikasian berkat bagian ujung meruncingnya yang unik. Panduan cepat untuk menentukan nuansa warna kulit: Nuansa warna kulit di sini bukan berarti sekedar warna kulit yang terang atau gelap. Rona yang dimaksud di sini adalah warna yang muncul dari bawah kulit yang akan mempengaruhi keseluruhan nuansa warna kulit Anda. Sejuk: Nuansa warna kebiruan, pink ataupun kemerahan Hangat: Ada sedikit sentuhan warna kuning, peach atau keemasan. Netral: Tidak ada nuansa warna kulit yang dominan. SEPTEMBER 2018 WORDS BY: BASAK KARAKUS PHOTOGRAPHS BY: ROBERT BERGGREN

1 1
30.05.2020 13:57:52
View

LANEIGE Lip Sleeping Mask 3gr Manfaat: 1. Berry Mix Complex Kaya akan vitamin C dan kandungan anti oksidan yang membuat bibir kering dan terkelupas menjadi halus dan kenyal。 2. Moisture Wrap Kaya akan Hyaluronic Acid Mineral Network yang terus meresap dalam bibir selama tertidur 3. Aroma berry yang segar Aroma menyenangkan yang membantu tidur pulas。 Cara Pemakaian oleskan di bibir yang bersih sebelum tidur,bersihkan pada pagi hari #dirumahsaja #somebymi #skincare #glowingskin #somethinc #laneige #innisfree #banilaco #makeup #huxley #klairs #theordinary #avoskin #lacoco #nacific #missha #wardah #pixy #naturerepublic #huxley #cosrx #cicapair #iunik #sunscreen #serum #toner #essence #nightcream #daycream #sleepingmask

0 5
30.05.2020 13:54:47
View

Terdiri dari : Yuja Niacin 30 Days Miracle Brightening Toner (30ml) Yuja Niacin 30 Days Blemish Care Serum (10ml) Yuja Niacin Brightening Moisture Gel Cream (30ml) Yuja Niacin 30 Days Miracle Brightening Sleeping Mask (20gr) Details : Yuja niacin ini terbuat dari Goheung citrus Vitamin C dan 3x lipat lebih banyak extract lemon. Dengan kandungan lemon extraxt dan niacinamide Mencerahkan kulit wajah dalam 30 hari. Membuat kulit lembab, kilau dan terasa segar pada besok harinya #dirumahsaja #somebymi #skincare #glowingskin #somethinc #laneige #innisfree #banilaco #makeup #huxley #klairs #theordinary #avoskin #lacoco #nacific #missha #wardah #pixy #naturerepublic #huxley #cosrx #cicapair #iunik #sunscreen #serum #toner #essence #nightcream #daycream #sleepingmask

0 5
30.05.2020 13:53:05
View

New Normal pastinya pingin dong kelihatan cantik dan kece karena bakalan bertemu dengan teman kantor ataupun teman kuliah. Nah kamu bisa terlihat catik dan tetap terlihat flawless dengan make up di atas dengan harga yang super kece juga di kantong✨ —— Order bisa via DM/ WA Pengiriman lewat J&T dan Grab Bisa COD sesuai dengan wilayah yang ada di bio❤️ ✨Happy Shopping✨ #makeup #makeupmurah #makeupmurahmalang #bodycare #bodycaremurah #bodycaremurahmalang #wardah #wardahmurah

0 2
30.05.2020 13:52:12
View

Buat yang mau coba snail series tapi maju mundur. Ini saatnya ya. Ukuran trial size buat coba-coba atau travelling. Gel Cleanser 30ml Toner 30ml Serum 10ml Cream 20g Fungsinya udah tau lah ya. Ini bagus banget buat beruntusan, bopeng, bekas jerawat dan jerawat kecil. Bahan natural bisa dipakai bumil and busui. Bahkan bisa dicampur sama krim dokter. #dirumahsaja #somebymi #skincare #glowingskin #somethinc #laneige #innisfree #banilaco #makeup #huxley #klairs #theordinary #avoskin #lacoco #nacific #missha #wardah #pixy #naturerepublic #huxley #cosrx #cicapair #iunik #sunscreen #serum #toner #essence #nightcream #daycream #sleepingmask

0 6
30.05.2020 13:51:25
View

Wardah Instaperfect MatteCentric Lip Crayon 3gr Harga: 77.000 Instaperfect Mattecentric Lip Crayon adalah lipstik berbentuk krayon yang praktis (set to go) dengan finish comfort matte, memiliki hasil warna yang intens, matte, dan tahan lama. Memiliki soft buttery texture yang lembut, ringan, tidak seret dan mengandung moisture boost formula yang menjaga kelembaban bibir Tersedia: 1. Pace 2. Morale 3. Honor 4. Joy 5. Sense 6. Soul Order? DM atau Line (link di bio) #wardah #wardahbogor #wardahjakarta #wardahdepok #wardahtanggerang #wardahbekasi #wardahgrosir #makeupwardah #skincarewardah #wardahinstaperfect #wardahinstaperfectseries #wardahinstaperfectmattecentriclipcrayon

0 7
30.05.2020 13:50:25
View

Hallo beauty🙂 Bersiap-siap untuk new normal! Untuk belanja produk favorite aku wardah, emina, dan makeover aku order di @shopspace.kotapadang dan @shopspace.bukityinggi Sekarang ini lagi bnyak promo cek aja langsung beauty Nah aku juga dapat vocher. Dan aku bakalan bagi bagi buat kalian yg mau belanja di akun shopee @shopspace.kotapadang Ikuti giveaway bagi bagi vocher ini yuk. Caranya gampang Kalian comment MAU dan tag teman2 kalian. Gampang kan Dan jgn lupa follow akun ig dan shopee nya @shopspace.kotapadang dan @shopspace.bukittinggi Ya beauty👄 #likeforlikes #like4likes #likeforfollow #likeforlikeback #lfl💛 #lfl #lfl #lfl❤️ #lflf #followforfollowback #followers #follow #followersaktif #wardah #wardahlipcreammatte

21 163
30.05.2020 13:46:58
View

Wardah Velvet 🥰 Superrrr Best seller banget dehhh 👌😉 Pilihan warna yg superrrr cantik dong 🥰🥰 Cumn 💰70k lohhh Buruan beli sekarang juga ya gaes 💃💃💃 Stock terbatas y gaes #termurah, #medan, #termurahseinstagram, #terpopuler, #shop, #grosir, #binjai, #terbest, #cantikalami, #beauty, #beautiful, #madamegie, #matte, #mattelipstick, #wardah, #lipstickmattemurah, #original, #bpom

0 0
30.05.2020 13:43:11
View

3 Trick Make-up Facelift Ingin mengakali tanda penuaan tanpa operasi plastik? Make-up adalah jawabannya! Mari simak 3 trik mudah berikut! 1. KULIT Sapukan bronzer di bawah tulang pipi, pelipis dan di bawah dagu Anda. Warna kulit akan terlihat lebih hangat dan segar dengan kontur yang tampak lebih 'terangkat'. 2. MATA Untuk efek mata kencang dan 'terbuka', hindari menggunakan eye shadow atau liner yang 'berat' bawah mata . Pulas eye shadow ke sudut luar mata membentuk segitiga kecil ke arah atas. Mata Anda akan 'terbuka' dengan instan! 3. ALIS Untuk sentuhan akhir tonjolkan kontur terbaik alis Anda dengan menyikatnya ke atas. Pertegas bentuk alis Anda dengan warna, dan 'kunci' tampilannya dengan eyebrow wax. NOVEMBER 2016 WORDS BY: SANNA FRANKLIN PHOTOGRAPHS BY: JOHN BUDDEE HAIR & MAKEUP: ÅSA ÖSTERGREN

1 1
30.05.2020 13:42:15
View

HAPLE Grapessed Oil 100% Pure and certified oil imported from Spain cold pressed-Refined-chermicals free. Have been proved that Grapeseed oil is really effective on fighting acne,tightening pores and perfect for acne prone skin,sensitive and normal to oily skin Here's the benefits you can get from our Grapeseed Oil : -acne prone treatment and helping prevent acne -tighten the skin and minimize pore size -non-comedogenic and effective on cleaning blackheads -oil control -healing breakouts,and cleaning acne scars -rich in linoleic acid and high antioxidant -absorbs easily into the skin heal wounds faster Also,you can use it to your hair for nourishing and strengthen your hair,it can also penetrates the scalp to stimulate blood circulation which promotes hair growth SANGAT DISARANKAN untuk menggunakan rose water dan Booster sebelum pemakaian oil karena dapat membantu penyerapan lebih cepat, lebih efektif dan lebih maksimal. gunakan saat wajah keadaan basah. Cara pakai: -basahkan wajah dahulu dengan rose water,biarkan wajah dalam keadaan basah. -tetes oil di tangan(pakai pagi sebelum make up dan malam sebelum tidur dan sebelum skincare routine) untuk pagi,pakai 2-4 tetes,malam 4-6 tetes(jika dicampur, dibagi 2 ratio 1:1) -gosok2 tangan hingga agak hangat untuk memanaskan oil -pijat dan tepok2 wajah(wajah dalam keadaan basah setelah di spray rose water) sangat bagus untuk dipakai sebelum make up,aman untuk digunakan dengan skincare lainnya. Aman untuk kulit sensitif. #dirumahsaja #somebymi #skincare #glowingskin #somethinc #laneige #innisfree #banilaco #makeup #huxley #klairs #theordinary #avoskin #lacoco #nacific #missha #wardah #pixy #naturerepublic #huxley #cosrx #cicapair #iunik #sunscreen #serum #toner #essence #nightcream #daycream #sleepingmask

0 4
30.05.2020 13:36:49
View

Wardah edisi premium dengan butiran emas membuat wajah jadi kencang dan bersinar. 1 paket isi 7 produk Rp 1.340.000 bisa ambil bijian jg😍 #kosmetikmurah #onlineshop #wardah #kecantikan #malang #bogor #jakarta #surabaya #bandung #medan

0 0
30.05.2020 13:36:03
View

HAPLE Rose Water 100ml As we know, The right way to using oils is when your face is on wet conditions, and when you use this Rose water before oils, you'll see a significant result! This makes your oils works faster, glowing your skin, make the oils absorb very quickly, refreshed and purify your skin and many more benefits such as: 1. Balancing the skin PH 2. Controls excess oil (but suitable for Dry skin too, because it's also moisturizing) 3. Has anti-inflammatory which can help you reduce the redness of the skin, get rid of acne, reduce dermatitis and eczema. 4. Deep cleansing. Removing oils and dirt in clogged pores. 5. Hydrate, revitalize and moisturize 6. Wound healing aid 7. Refreshed and purify the skin 8. Prevent breakouts 9. As an anti-aging, reduce fine lines and dark circles Dapat digunakan untuk rambut dan tubuh. Untuk rambut, pakai setelah keramas :) Sangat bagus untuk dipakai sebelum make up,aman untuk digunakan dengan skincare lainnya. Aman untuk kulit sensitif. The First Face oil and Rose Water brand in Indonesia! Sekarang, banyak Rose Water yang beredar di pasaran, tapi pastikan kamu mendapatkan produk dengan kualitas terbaik ya :) Rose Water Haple adalah yang Brand pertama yang mempopulerkan kombinasi Rose Water dan Face oil di Indonesia, dan sudah terbukti diproduksi di pabrik yang higenis, memiliki kualitas yang sangat baik, 100% Pure dan sudah ada ribuan testimoninya , jangan sekedar tergiur dengan harga yang lebih murah ( dengan kualitas yang tidak terjamin dan menjiplak dari brand kami ) apalagi tanpa BPOM ya guys :) Invest the best for your skin! *Penyimpanan 2 minggu di suhu ruangan, 6 bulan jika disimpan di kulkas #dirumahsaja #somebymi #skincare #glowingskin #somethinc #laneige #innisfree #banilaco #makeup #huxley #klairs #theordinary #avoskin #lacoco #nacific #missha #wardah #pixy #naturerepublic #huxley #cosrx #cicapair #iunik #sunscreen #serum #toner #essence #nightcream #daycream #sleepingmask

0 3
30.05.2020 13:32:00
View

Warna natural hingga bold, semuanya tersedia lengkap pada Wardah exclusive matte lipcream! Varian shades nude bisa jadi handalan tampil natural sehari-hari. Untuk tampilan lebih fressh dan ceria, pilih shades pink atau peach pilihanmu. Lalu, kalau untuk Glam night, tentukan shades merah yang tepat untuk tampilan makeupmu ❣️ . #lipcream #wardahkosmetik #wardah #wardahbeauty #wardahmurah #wardahlipcream #wardahexclusivemattelipcream

0 2
30.05.2020 13:31:17
View

✨Lipstik Halal dari wardah yaitu Intensive matte lipstick✨. dengan warna yang lebih intens,tidak mengkilap, lembut dibibir dan tidak membuat bibir kering. Wardah Intense Matte Lipstick ini dikemas dalam box yang design nya super kece, simpel dan keliatan berkelas. Setiap warna dari kemasan box luarnya kaya nunjukin warna shade yang ada di dalamnya. Lalu untuk nama dari setiap shade nya ada di bagian depan box nya. Price : 44.000/pcs Cara Penggunaan: Oleskan secara merata dengan lembut pada bibir bagian atas dan bawah dengan ujung jari. Dapat diaplikasikan berkali-kali . FOR ORDER LINK ADA DIBIO YAA . . #makeupmalang #makeupmurahmalang #jualmakeup #jualmakeupmurah #jualmakeupmalang #makeupmurah #skincaremalang #wardahmurah #wardahsurabaya #wardahmalang #wardah #makeupkece #makeuppesta #naturalmakeup #stylist #skincaremurahmalang #skincaremurah #wardah #lfl #fff

0 1
30.05.2020 13:29:15
View

Emina Ms Pimple Acne Solution Face Toner Mengandung banyak zinc Gluconate dan extract Whitch Hazel yang mengurangi produksi minyak berlebih dan menyegarkan kulit wajah. Dengan formula ringan, alcohol free dan pJ balanced, aman digunakan untuk kulit normal cenderung berminyak dan kulit berjerawat. HOW TO USE: Tuang produk pada wajah setelah membersihkan wajah menggunakan kapas atau langsung ke tangan. #dirumahsaja #somebymi #skincare #glowingskin #somethinc #laneige #innisfree #banilaco #makeup #huxley #klairs #theordinary #avoskin #lacoco #nacific #missha #wardah #pixy #naturerepublic #huxley #cosrx #cicapair #iunik #sunscreen #serum #toner #essence #nightcream #daycream #sleepingmask

0 6
30.05.2020 13:28:03
View

EMINA The Bright Stuff Face Toner Meringkas pori dan membuat kulit wajah terasa segar dengan efek mencerahkan 1. Mengandung vitamin B3 dan Licorice extract untuk mencerahkan 2. Formula non alkohol 3. Cocok untuk kulit kusam #dirumahsaja #somebymi #skincare #glowingskin #somethinc #laneige #innisfree #banilaco #makeup #huxley #klairs #theordinary #avoskin #lacoco #nacific #missha #wardah #pixy #naturerepublic #huxley #cosrx #cicapair #iunik #sunscreen #serum #toner #essence #nightcream #daycream #sleepingmask

0 6
30.05.2020 13:25:08
View

*Crystallure Superme Revitalizing Rich Cream* Krim wajah bertekstur kaya namun bebas lengket dan tidak berminyak ini dilengkapi dengan perlindungan SPF 35 PA+++. Produk ini mengoptimalkan peremajaan kulit untuk tampilan wajah lebih muda bercahaya serta melindunginya. Kandungan natural instant brightening membantu menjadikan wajah tampak lebih cerah dan warnanya terlihat lebih merata. Tekstur krim ini begitu ringan dengan hasil akhir yang membuat wajah tampak halus. Saat akan menggunakan krim ini di pagi hari, pastikan wajah dan tangan Anda sudah bersih dari kotoran. Gunakan spatula khusus yang diberikan bersama produk ini untuk mengambil krim dari kemasannya dan aplikasikan di wajah sesuai kebutuhan. Pijat lembut mulai dari bagian dalam wajah ke arah luar. Tepuk ringan ke seluruh wajah untuk memastikan produk diserap dengan baik. . . =========================== 🌹 Pertanyaan & Pemesanan: Wa: 087880001328 🌹 Pertanyaan melalui DM & Komen dibalas Slowrespon 🌹 Cek one Brand tutorial makeup @wardahproduk 🌹 Keaslian produk terjamin 🌹 Pengiriman dari Depok 🌹 Kirim ke Seluruh Indonesia, Malaysia, Hongkong, Singapura 🌹 Join Reseller, syarat & cara daftar hub WA =========================== . . #wardahCrystallure #wardah #skincare #skincareroutine #glowingskin #glowingskincare #antiaging #antiagingskincare #antiagingglow

0 7
30.05.2020 13:24:42
View

4 Tren Tampilan Pesta 2020 Sambut hari baru dengan ceria! Yuk, lihat inspirasinya melalui ulasan di bawah ini 1.Bibir Cantik Berkilau Bibir mengkilap sedang hits dan akan terus menjadi hits di tahun 2020! Tampilan baru yang mencolok mulai muncul di acara Fashion setahun yang lalu, dan kami melihat semakin banyak selebriti dan bintang Instagram tampil bertabur kilap. 2.MATA METALIK Metallics kembali dengan cara yang besar - dari eye shador shimmer lembut hingga glitter yang mencolok. Coba Giordani Gold Eye Shadow Squad dan biarkan mata metalik Anda mengerjap cantik! 3.KUKU GEMERLAP Jangan lupa manicure meriah! Bejeweled dan gemerlap, glitter memberi tekstur kuku Anda dan membuat mereka bersinar gemilangvdi malam hari. Kami saat ini terpesona oleh glitter seperti confetti di atas dasar krem, pink atau coklat. Pilih The One longwear Nail polish 4. PELANGI DI MATAMU Kelap kelip dan metalik bukan selera Anda? Tidak masalah, coba bereksperimen dengan beragam warna yang akan membuat mata Anda terlihat lebih ekspresif seperti kepribadian Anda yang dinamis. Pilih rangkaian eye shadow yang akan membuat mata lain tak berkedip memandang Anda! NOVEMBER 2017 WORDS BY: SANNA FRANKLIN PHOTOGRAPHS BY: GETTY

1 2
30.05.2020 13:20:44
View

Nature Daily Series - Wardah Aloe Hydramild Moisturizer Cream 40 ml Harga 20.000 - Wardah Aloe Hydramild Facial Wash Harga 60 ml 16.000 & 100 ml 26.000 - Wardah Aloe Hydramild Multifunction Gel 100 ml Harga 36.000 - Wardah Aloe Hydramild Serum 5x5 ml Harga 45.000 - Wardah Seaweed Balancing Cleanser 150 ml Harga 23.000 - Wardah Seaweed Balancing Toner 150 ml Harga 23.000 - Wardah Seaweed Cleansing Micellar Water Harga 100 ml 27.000 & 240 ml 49.000 - Wardah Seaweed Balancing Facial Mask 60 ml Harga 18.000 - Wardah Seaweed Primary Hydrating Skin Booster 100 ml Harga 33.000 - Wardah Seaweed Balancing Facial Wash 60 ml Harga 15.000 - Wardah Seaweed Balancing Facial Scrub 60 ml Harga 15.000 - Wardah Seaweed Intensive Night Cream 30 gr Harga 23.000 - Wardah Witch Hazel Purifying Moisturizer Gel 40 ml Harga 20.000 - Wardah Sunscreen Gel SPF 30 - 40 ml Harga 32.000 - Wardah Witch Hazel Purifying Facial Serum 5x5 ml Harga 45.000 #naturedailyserieswardah #wardah #wardahcosmetics #wardahcantikdarihati #wajahalami #wajahglowing #wajahbersih #cantik #kecantikan #kecantikanwajah #love #lovequotes #taglikeforlikes #likeforlikes #jakartahits #indonesian #lighteningserieswardah #wardah #wardahcosmetics #wardahcantikdarihati #wajahalami #wajahglowing #wajahbersih #cantik #kecantikan #kecantikanwajah #love #lovequotes #taglikeforlikes #likeforlikes #jakartahits #indonesian

0 0
30.05.2020 13:20:02
View

Make Up pura-pura liburan 🤣🙂🍊 __________________________________ Haii, di makeup kali ini aku gak pakai complexion yang "flawless"/"full coverage". Disini aku menjadi aku yang sedang tidak berusaha menutupi banyak bekas jerawat dan sedikit bekas luka waktu kecil di wajahku. #SelfLove Produk: 🍊 @skinaquaid UV Moisture Milk SPF50+PA++++ 🍊 @brunbrun_paris Smooth Cover Cushion Foundation (Rosy Almond) || finishnya dewy, coveragenya medium tapi ini tipe cushion yang aku suka untuk sehari-hari. 🍊 @pixycosmetics Concealing Base (02 Sand Beige) 🍊 @brunbrun_paris Magic Bronze Blushing Cream || asli cantik banget warnanya dan ngestain lama di wajah luuvvv 🍊 @ultimaii_id Translucent Face Powder (006 Golden Beige) 🍊 @somethincofficial Dolcevita Face Palette || super cintaaaa! Harga terjangkau, warnanya cantik dan pigmentasinya oke punya!! 🍊 Maybelline Hyper Impact Liner 🍊 @wardahbeauty EyeXpert Curl Mascara 🍊 @brunbrun_paris Lip Glacé (Bare Sparkle) 🍊 @brunbrun_paris Lip Cheek Eye Color Classical Musik: IU -Blueming #tampilcantik @tampilcantik #makeuptutorial #sunkissed #makeup #beauty #fiiddandan #makeuptutorialindonesia #makeuppemula #brunbrun_paris #wardah #maybelline

0 4
30.05.2020 12:20:04
View

WARDAH Everyday Luminous Two Way Cake 12 g HARGA : 48RB ORDER : DM Wardah Everyday Luminous Two Way Cake mengandung oil control untuk wajah bebas kilap dan Vitamin E sebagai moisturizer dan antioksidan yang membantu mencegah penuaan dini. Bedak ini menyatu di kulit sangat natural dan dapat menyamarkan noda flek hitam. Memiliki tekstur lembut dan halus serta tidak mengandung bahan yang bersifat comedogenic yang artinya bila digunakan tidak akan menyumbat pori-pori dan tidak menimbulkan jerawat (selama proses pembersihan wajah dilakukan secara teratur). Detail: - Two way cake - Mengandung oil control untuk wajah bebas kilap - Vitamin E sebagai moisturizer dan antioksidan yang membantu mencegah penuaan dini - Menyatu di kulit sangat natural - Dapat menyamarkan noda flek hitam Ready no 4 natural #wardah #bedakpadatwardah #bedakpadat #naturalbedakpadat #wardahoriginal #twowaycake #inkatoko #kebumencantik #makeupkebumen #skincare

0 1
30.05.2020 11:40:39
View

❤️ #dirumahaja #instagood #wardah #makeup

2 41
30.05.2020 09:56:46
View

Innisfree Daily Mild Sunscreen SPF50+ PA++++ 50ML Tabir surya yang menyegarkan dengan ekstrak daun lidah buaya. Perkenalan Produk : 1. Water-based formula Diserap oleh kulit dengan cepat dan melembapkan kulit. 2. Perawatan kulit yang sehat Mengandung bahan-bahan yang lembut sehingga merawat kulit dengan lembut dan sehat. 3. Efek menetralkan dan melembapakan kulit Mengandung ekstrak daun lidah buaya untuk menetralkan dan melembapkan kulit. Cara penggunaan: Pada tahap terakhir rutin perawatan kulit oleskan secara merata pada area wajah, leher, lengan dan kaki yang mudah terkena sinar matahari. #dirumahsaja #somebymi #skincare #glowingskin #somethinc #laneige #innisfree #banilaco #makeup #huxley #klairs #theordinary #avoskin #lacoco #nacific #missha #wardah #pixy #naturerepublic #huxley #cosrx #cicapair #iunik #sunscreen #serum #toner #essence #nightcream #daycream #sleepingmask

0 15
29.05.2020 16:29:50
View

Toner untuk kulit berjerawat yang membantu membersihkan dan mengangkat kotoran penyebab jerawat dengan kandungan salicylic acid dan alkohol alami dari Bija. Produk ini bisa digunakan semua jenis kulit yang memiliki masalah acne. Perkenalan Produk : 1. Mengandung bija oil dari pulau Jeju yang bermanfaat untuk memperbaiki kulit bermasalah. 2. Diperkaya dengan kandungan asam salisilat alami untuk eksfoliasi dan membantu menyamarkan noda wajah. 3. Alkohol yang difermentasi secara alami membantu menenangkan kulit. Urutan pemakaian : Bija Trouble Cleansing Gel > Facial Foam > Skin Toner > Spot Essence (Special Care) > Lotion > Gel Cream Cara penggunaan: Gunakan produk setiap hari, pagi dan malam. Tuangkan produk dikapas lalu tap tap ke seluruh muka #dirumahsaja #somebymi #skincare #glowingskin #somethinc #laneige #innisfree #banilaco #makeup #huxley #klairs #theordinary #avoskin #lacoco #nacific #missha #wardah #pixy #naturerepublic #huxley #cosrx #cicapair #iunik #sunscreen #serum #toner #essence #nightcream #daycream #sleepingmask

0 15
29.05.2020 16:28:11
View

GLOSSIER Super Glow Brighter skin, bottled. Ever wish you could turn up the brightness on your skin? Super Glow does just that. Vitamin C and Magnesium (two things your body needs anyway!) energize and even the look of skin tone, creating a light-reflecting complexion. The milky emulsion soaks in immediately, delivering a delicate balance of 5% Magnesium Ascorbyl Phosphate (MAP for short-it's a more stable form of Vitamin C) with Magnesium PCA's mineral properties to improve the look of dark spots without irritation. Skin feels as if it's been recharged, like a fresh battery at 100%. Use it after late nights at the office or 4am Instagram holes. Add Super Glow to your daily routine for that "lit from within" look, all the time. Net 30ml #dirumahsaja #somebymi #skincare #glowingskin #somethinc #laneige #innisfree #banilaco #makeup #huxley #klairs #theordinary #avoskin #lacoco #nacific #missha #wardah #pixy #naturerepublic #huxley #cosrx #cicapair #iunik #sunscreen #serum #toner #essence #nightcream #daycream #sleepingmask

0 13
29.05.2020 16:25:23
View

Emina Glossy Stain Original 100% lip tint dengan gloss finish yang nyaman digunakan sehari-hari karena tekstur gel nya yang ringan dan tidak terasa berminyak. Dilengkapi dengan Apricot & Avocado Oil sebagai Moisturizing active yang memberikan kelembaban pada bibir dibandingkan lip tint dengan finish matte. Tersedia dalam 5 varian warna yang wearable untuk memberikan tampilan warna kilau bibir yang natural. 01 Autumn Bell 02 Apple Shower 03 Candy Rain 04 Peach Sprinkle 05 Spring Dazzle Limited stock, Hurry UP girls!!!! 42.000 #msgloworiginal #msglowmedan #msglowbpom #kosmetikmurahmedan #tokokosmetik #kosmetikoriginal #kosmetikremaja #makeupmedan #kosmetikmurah #wardahmedan #eminamedan #jualkosmetik #msglow #softlens #soflens #creammsglow #hanasui #emina #wardah #wardahmedan #eminamedan #imploramedan #madamgie #madamgiemedan #kutekhalal #deospraysr12 #sr12medan

0 1
27.05.2020 03:48:24
View